NR4A2 is a member of the steroid-thyroid hormone-retinoid receptor superfamily.
The protein may act as a transcription factor.
Mutations in NR4A2 gene have been associated with disorders related to dopaminergic dysfunction, including Parkinson disease, schizophernia, and manic depression.
Misregulation of NR4A2 gene may be associated with rheumatoid arthritis.This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily.
The encoded protein may act as a transcription factor.
Mutations in this gene have been associated with disorders related to dopaminergic dysfunction, including Parkinson disease, schizophernia, and manic depression.
Misregulation of this gene may be associated with rheumatoid arthritis.
Four transcript variants encoding four distinct isoforms have been identified for this gene.
Additional alternate splice variants may exist, but their full length nature has not been determined.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilutions:Optimal dilutions to be determined by the researcher.
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by affinity chromatography.
Form：Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Specificity：Recognizes human NR4A2. Species Crossreactivity: bovine, canine, guinea pig, equine, mouse, rabbit, rat and zebrafish
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Bo Ca Eq Gp Hu Mo Rb Rt Ze
Immunogen：Synthetic peptide corresponding to a fragment of residues within the following region of human NR4A2: NGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLF.
