KRT10 is a member of the type I (acidic) cytokeratin family, which belongs to the superfamily of intermediate filament (IF) proteins.
Keratins are heteropolymeric structural proteins which form the intermediate filament.
These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells.
Mutations in the gene encoding KRT10 are associated with epidermolytic hyperkeratosis.
This gene encodes a member of the type I (acidic) cytokeratin family, which belongs to the superfamily of intermediate filament (IF) proteins.
Keratins are heteropolymeric structural proteins which form the intermediate filament.
These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells.
Mutations in this gene are associated with epidermolytic hyperkeratosis.
This gene is located within a cluster of keratin family members on chromosome 17q21.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by affinity chromatography.
Form：Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Specificity：Recognizes human KRT10. Species crossreactivity: mouse
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu Mo
Immunogen：Synthetic peptide located within the following region: EKVTMQNLNDRLASYLDKVRALEESNYELEGKIKEWYEKHGNSHQGEPRD of the N-terminal region of human KRT10. Species sequence homology: rat, bovine, canine, equine, porcine, rabbit
