HR is a protein whose function has been linked to hair growth.
A similar protein in rat functions as a transcriptional corepressor for thyroid hormone and interacts with histone deacetylases.
Mutations in this gene have been documented in cases of autosomal recessive congenital alopecia and atrichia with papular lesions.This gene encodes a protein whose function has been linked to hair growth.
A similar protein in rat functions as a transcriptional corepressor for thyroid hormone and interacts with histone deacetylases.
Mutations in this gene have been documented in cases of autosomal recessive congenital alopecia and atrichia with papular lesions.
Two transcript variants encoding different isoforms have been found for this gene.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by affinity chromatography.
Form：Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Specificity：Recognizes human HR.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide located within the following region of human HR: RVWAPGDAGQQKESTQKTPPTPQPSCNGDTHRTKSIKEETPDSAETPAED
