HLA-DOB belongs to the HLA class II beta chain paralogues.
This class II molecule is a heterodimer consisting of an alpha (DOA) and a beta chain (DOB), both anchored in the membrane.
It is located in intracellular vesicles.
DO suppresses peptide loading of MHC class II molecules by inhibiting HLA-DM.
Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages).
The beta chain is approximately 26-28 kDa and its gene contains 6 exons.
Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 1ug/ml HepG2 whole cell lysatesOptimal dilutions to be determined by the researcher.
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by affinity chromatography.
Form：Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Specificity：Recognizes human HLA-DOB.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide located within the following region: LTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNLEEYVR of the N-terminal region of human HLA-DOB. Species Sequence Homology: bovine, canine, equine, porcine, rabbit and sheep.
