H13 catalyzes intramembrane proteolysis of some signal peptides after they have been cleaved from a preprotein, resulting in the release of the fragment from the ER membrane into the cytoplasm.
It is required to generate lymphocyte cell surface (HLA-E) epitopes derived from MHC class I signal peptides.
Involved in the intramembrane cleavage of the integral membrane protein PSEN1 By similarity.
It may play a role in graft rejection.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ul
Host：rabbit
Source Antibody：mouse
Grade：Affinity Purified
Purity：Purified by affinity chromatography.
Form：Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Specificity：Recognizes mouse H13.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Mo
Immunogen：Synthetic peptide corresponding to a fragment of residues within the followng sequence in mouse H13: KLVFPQDLLEKGLEADNFAMLGLGDIVIPGIFIALLLRFDISLKKNTHT
