GUSB plays an important role in the degradation of dermatan and keratan sulfates.
Applications:Suitable for use in Immunohistochemistry and Western Blot.
Other applications not tested.
Recommended Dilutions:Western Blot: 2.5ug/ml using HepG2 cell lysate as positive controlImmunohistochemistry (Paraffin): 4-8ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, 0.09% sodium azide, 2% sucrose.
Specificity：Recognizes human GUSB.
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide located within the following region at the C-terminal region: VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF of human GUSB.
