FGA is the alpha component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains.
Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots.
In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types.
Mutations in its gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia, afibrinogenemia and renal amyloidosis.The protein encoded by this gene is the alpha component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains.
Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots.
In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types.
Mutations in this gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia, afibrinogenemia and renal amyloidosis.
Alternative splicing results in two isoforms which vary in the carboxy-terminus.
Applications:Suitable for use in Immunohistochemistry and Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 5ug/ml Jurkat cell lysatesImmunohistochemistry: 4-8ug/ml human skin tissueOptimal dilutions to be determined by the researcher.
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Specificity:Recognizes human FGA.
Isotype:IgG
Calc Applications Abbrev:IHC WB
Calc Crossreactivity:Hu
Immunogen:Synthetic peptide located within the following region: MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDSAA, of the N-terminal region of human FGA. Species Sequence Homology: bovine, canine, goat, equine, porcine, rat, mouse, sheep.