Electron transport pathways are generally associated with mitochondrial membranes, but non-mitochondrial pathways are also biologically significant.
Plasma membrane electron transport pathways are involved in functions as diverse as cellular defense, intracellular redox homeostasis, and control of cell growth and survival.
Members of the ecto-NOX family, such as CNOX, or ENOX1, are involved in plasma membrane transport pathways.
These enzymes exhibit both a hydroquinone (NADH) oxidase activity and a protein disulfide-thiol interchange activity in series, with each activity cycling every 22 to 26 minutes.Electron transport pathways are generally associated with mitochondrial membranes, but non-mitochondrial pathways are also biologically significant.
Plasma membrane electron transport pathways are involved in functions as diverse as cellular defense, intracellular redox homeostasis, and control of cell growth and survival.
Members of the ecto-NOX family, such as CNOX, or ENOX1, are involved in plasma membrane transport pathways.
These enzymes exhibit both a hydroquinone (NADH) oxidase activity and a protein disulfide-thiol interchange activity in series, with each activity cycling every 22 to 26 minutes (Scarlett et al., 2005 [PubMed 15882838]).[supplied by OMIM].
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by affinity chromatography.
Form:Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Specificity:Recognizes human ENOX1.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Synthetic peptide located within the following region of human ENOX1: QQLQFLQQTMQGMQQQLLTIQEELNNKKSELEQAKEEQSHTQALLKVLQE. Species sequence homology: bovine: 100%; canine: 100%; guinea pig: 100%; equine: 100%; mouse: 100%; rabbit: 100%; rat: 100%; yeast: 83%