DNASE2B shares considerable sequence similarity to, and is structurally related to DNase II.
The latter is a well characterized endonuclease that catalyzes DNA hydrolysis in the absence of divalent cations at acidic pH.
Unlike DNase II which is ubiquitously expressed, expression of this protein is restricted to the salivary gland and lungs.
The protein encoded by this gene shares considerable sequence similarity to, and is structurally related to DNase II.
The latter is a well characterized endonuclease that catalyzes DNA hydrolysis in the absence of divalent cations at acidic pH.
Unlike DNase II which is ubiquitously expressed, expression of this gene product is restricted to the salivary gland and lungs.
The gene has been localized to chromosome 1p22.3 adjacent (and in opposite orientation) to the uricase pseudogene.
Two transcript variants encoding different isoforms have been described for this gene.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by affinity chromatography.
Form：Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Specificity：Recognizes human DNASE2B.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide corresponding to a fragment of residues within the following region of human DNASE2B: QKGTKNRWTCIGDLNRSPHQAFRSGGFICTQNWQIYQAFQGLVLYYESCK
