The protein encoded by this gene is essential for meiotic homologous recombination.
Genetic recombination in meiosis plays an important role in generating diversity of genetic information.
The product of this gene is structurally and evolutionary related to the products of the yeast RAD51 and E.
coli RecA genes.
Alternative splice variants of this gene have been described but their full-length nature has not been determined.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by affinity chromatography.
Form：Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Specificity：Recognizes human DMC1. Species Crossreactivity: mouse
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu Mo
Immunogen：Synthetic peptide located within the following region of human DMC1: GIQMTTRRALCNVKGLSEAKVDKIKEAANKLIEPGFLTAFEYSEKRKMVF. Species sequence homology: bovine: 100%; canine: 100%; goat: 92%; guinea pig: 93%; equine: 100%; porcine 100%; rabbit: 100%; rat: 100%; yeast: 92%; zebrafish: 93%
