CSH1 is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control.
This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites.
Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, although the ratio of 1 to 2 increases by term.
Mutations in this gene result in placental lactogen deficiency and Silver-Russell syndrome.The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control.
The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications.
Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues.
Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization.
This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites.
Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, although the ratio of 1 to 2 increases by term.
Mutations in this gene result in placental lactogen deficiency and Silver-Russell syndrome.
Applications:Suitable for use in Immunohistochemistry and Western Blot.
Other applications not tested.
Recommended Dilution:Immunohistochemistry (Paraffin): 4-8ug/mlWestern Blot: 1.25ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Specificity:Recognizes human CSH1.
Isotype:IgG
Calc Applications Abbrev:IHC WB
Calc Crossreactivity:Hu
Immunogen:Synthetic peptide located within the following region: SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYS of the middle region of human CSH1. Sequence Homology: canine, guinea pig, rabbit, rat