This gene encodes a type I membrane protein that is a member of the immunoglobulin superfamily.
This protein is expressed by antigen-presenting cells, and it is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4.
Binding of this protein with CD28 antigen is a costimulatory signal for activation of the T-cell.
Binding of this protein with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response.
Alternative splicing results in several transcript variants encoding different isoforms.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilutions:Western Blot: 1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by affinity chromatography.
Form:Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Specificity:Recognizes human CD86.
Isotype:IgG
Calc Applications Abbrev:WB
Immunogen:Synthetic peptide corresponding to within the following region WKKKKRPRNSYKCGTNTMEREESEQTKKREKIHIPERSDEAQRVFKSSKT from human CD68. Species sequence homology: porcine 92%.