Casp3 is involved in the activation cascade of caspases responsible for apoptosis execution.
At the onset of apoptosis it proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond, cleaves and activates sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix leucine zipper domain and the membrane attachment domain, cleaves and activates caspase-6, -7 and -9, triggers cell adhesion in sympathetic neurons through RET cleavage, cleaves IL-1 beta between an Asp and an Ala, releasing the mature cytokine which is involved in a variety of inflammatory processes.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ul
Host：rabbit
Source Antibody：mouse
Grade：Affinity Purified
Purity：Purified by affinity chromatography.
Form：Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Specificity：Recognizes mouse CASP3.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Mo
Immunogen：Synthetic peptide located within the following region: LTGKPKLFIIQACRGTELDCGIETDSGTDEEMACQKIPVEADFLYAYSTA of the middle region of mouse Casp3. Species sequence homology: bovine, canine, goat, guinea pig, equine, human, porcine, rat, sheep.
