This gene encodes a member of the Aurora subfamily of serine/threonine protein kinases.
The encoded protein is a chromosomal passenger protein that forms complexes with Aurora-B and inner centromere proteins and may play a role in organizing microtubules in relation to centrosome/spindle function during mitosis.
This gene is overexpressed in several cancer cell lines, suggesting an involvement in oncogenic signal transduction.
Alternative splicing results in multiple transcript variants.
Applications:Suitable for use in .
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ul
Host：rabbit
Grade：Affinity Purified
Purity：Purified by affinity chromatography.
Form：Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Specificity：Recognizes AURKC.
Isotype：IgG
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide corresponding to the following sequence PRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGK
