The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases.
Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane.
These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle.
This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta).
The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes.
This gene encodes an alpha 2 subunit.
Mutations in this gene result in familial basilar or hemiplegic migraines, and in a rare syndrome known as alternating hemiplegia of childhood.
Applications:Suitable for use in ELISA.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by affinity chromatography.
Form:Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Specificity:Recognizes human ATP1A2.
Isotype:IgG
Calc Applications Abbrev:E
Calc Crossreactivity:Hu
Immunogen:Synthetic peptide located within the following region: ISLAYEAAESDIMKRQPRNSQTDKLVNERLISMAYGQIGMIQALGGFFTY of human ATP1A2. Species sequence homology: bovine, canine, guinea pig, equine, mouse, rabbit, rat, sheep, zebrafish