The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs.
S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation.
S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 4p16.
This protein, in addition to binding Ca2+, also binds Zn2+ and Mg2+.
This protein may play a role in the etiology of prostate cancer.
[provided by RefSeq]
Applications:Suitable for use in Immunofluorescence, Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLME KELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFI VFVAAITSACHKYFEKAGLK
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
