This gene belongs to the NPY family and it encodes a protein that is synthesized as a aa95 polypeptide precursor in the pancreatic islets of Langerhans.
It is cleaved into two peptide products; the active hormone of aa36 and an icosapeptide of unknown function.
The hormone acts as a regulator of pancreatic and gastrointestinal functions and may be important in the regulation of food intake.
Plasma level of this hormone has been shown to be reduced in conditions associated with increased food intake and elevated in anorexia nervosa.
In addition, infusion of this hormone in obese rodents has shown to decrease weight gain.
[provided by RefSeq]
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPG DNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLA FSEWGSPHAAVPRELSPLDL
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ul
Host:mouse
Source Antibody:human
Grade:Purified
Purity:Purified
Form:Supplied as a liquid. No preservative added.
Specificity:Recognizes human PPY
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Protein correspomding to aa1-95 from full length human PPY.