This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily.
The encoded glycoprotein is a small type II membrane receptor with an extracellular C-type lectin-like domain fold and a cytoplasmic domain with an immunoreceptor tyrosine-based activation motif.
It functions as a pattern-recognition receptor that recognizes a variety of beta-1,3-linked and beta-1,6-linked glucans from fungi and plants, and in this way plays a role in innate immune response.
Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region.
[provided by RefSeq]
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MEYHPDLENLDEDGYTQLHFDSQSNTRIAVVSEKGSC AASPPWRLIAVILGILCLVILVIAVVLGTMAGFKAVEFKG
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ul
Host:mouse
Source Antibody:human
Grade:Purified
Purity:Purified
Form:Supplied as a liquid. No preservative added.
Specificity:Recognizes human CLEC7A
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Protein corresponding to aa1-77 from full length human CLEC7A