84-4690-87 SKP2 (S-Phase Kinase-Associated Protein 2, Cyclin-A/CDK2-Associated Protein p45, F-box Protein Skp2, F-box/LRR-Repeat Protein 1, p45skp2, FBXL1) 100ug 397550
84-4690-87 SKP2 (S-Phase Kinase-Associated Protein 2, Cyclin-A/CDK2-Associated Protein p45, F-box Protein Skp2, F-box/LRR-Repeat Protein 1, p45skp2, FBXL1) 100ug 397550
The F box protein Skp2 (S-phase kinase-associated protein 2) is oncogenic, and its frequent amplification and overexpression correlate with the grade of malignancy of certain tumors.
Skp2 controls p300-p53 signaling pathways in cancer cells, making it a potential molecular target for cancer therapy.
This gene positively regulates the G(1)-S transition by controlling the stability of several G(1) regulators, such as the cell cycle inhibitor p27.
This study provides evidence of a role for an F-box protein in oncogenesis and establishes SKP2 as a protooncogene causally involved in the pathogenesis of lymphomas.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/ml Optimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size:100ug
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by immunoaffinity chromatography.
Form:Supplied as a lyophilized powder in 5mg/ml BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O to ~0.5mg/ml.
Specificity:Recognizes human SKP2. Species Crossreactivity: mouse, rat.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu Mo Rt
Immunogen:Synthetic peptide corresponding to a sequence ETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHL of human SKP2.