DC-SIGN (Dendritic Cell-Specific Intercellular adhesion molecule-3-Grabbing Non-integrin) also known as CD209 (Cluster of Differentiation 209) is a protein which in humans is encoded by the CD209 gene.
This gene encodes a transmembrane receptor and is often referred to as DC-SIGN because of its expression on the surface of dendritic cells and macrophages.
The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses with a large impact on public health.
The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain.
The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells.
The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity.
Variations in the number of 23aa repeats in the neck domain of this protein are rare but have a significant impact on ligand binding ability.
This gene is closely related in terms of both sequence and function to a neighboring gene.
DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution.
Alternative splicing results in multiple variants.
Applications:Suitable for use in Western Blot, Flow Cytometry and Immunohistochemistry.
Other applications not tested.
Recommended Dilutions:Western Blot: 0.1-0.5ug/mlImmunohistochemistry (Paraffin): 0.5-1ug/ml boiling the paraffin sections in 10mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections
Flow Cytometry: 1-3ug/1x10e6 cellsOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 0.05% sodium azide, 4% trehalose. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes human CD209.
Isotype：IgG
Calc Applications Abbrev：FC IHC WB
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide corresponding to MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLA of human CD209.
