C-C chemokine receptor type 3, also called CCR3 or CKR3 is a protein that in humans is encoded by the CCR3 gene.
The protein encoded by this gene is a receptor for C-C type chemokines.
It belongs to family 1 of the G protein-coupled receptors.
This gene and seven other chemokine receptor genes form a chemokine receptor gene cluster on the chromosomal region 3p21.
This receptor binds and responds to a variety of chemokines, including eotaxin (CCL11), eotaxin-3 (CCL26), MCP-3 (CCL7), MCP-4 (CCL13), and RANTES (CCL5).
It is highly expressed in eosinophils and basophils, and is also detected in TH1 and TH2 cells, as well as in airway epithelial cells.
This receptor may contribute to the accumulation and activation of eosinophils and other inflammatory cells in the allergic airway.
It is also known to be an entry co-receptor for HIV-1.
Alternatively spliced transcript variants have been described.
Applications:Suitable for use in Flow Cytometry, Western Blot, Immunohistochemistry and Immunocytochemistry.
Other applications not tested.
Recommended Dilution:Flow Cytometry: 1-3ug/1x10e6 cellsWestern Blot: 0.1-0.5ug/mlImmunohistochemistry (frozen): 0.5-1ug/mlImmunocytochemistry: 0.5-1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size:100ug
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by immunoaffinity chromatography.
Form:Supplied as a lyophilized powder from PBS, 4% trehalose, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity:Recognizes human CCR3. Species Crossreactivity: mouse and rat.
Isotype:IgG
Calc Applications Abbrev:FC IC IHC WB
Calc Crossreactivity:Hu Mo Rt
Immunogen:Synthetic peptide corresponding to a sequence MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMA of human CCR3.