Tumor necrosis factor-inducible gene 6 protein, also known as TSG-6, is a protein that in humans is encoded by the TNFAIP6 gene.
The protein encoded by this gene is a secretory protein that contains a hyaluronan-binding domain, and thus is a member of the hyaluronan-binding protein family.
The hyaluronan-binding domain is known to be involved in extracellular matrix stability and cell migration.
This protein has been shown to form a stable complex with inter-alpha-inhibitor (I alpha I), and thus enhance the serine protease inhibitory activity of I alpha I, which is important in the protease network associated with inflammation.
This gene can be induced by proinflammatory cytokines such as tumor necrosis factor alpha and interleukin-1.
Enhanced levels of this protein are found in the synovial fluid of patients with osteoarthritis and rheumatoid arthritis.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size:100ug
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by immunoaffinity chromatography.
Form:Supplied as a lyophilized powder in 5mg/ml BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O to ~0.5mg/ml.
Specificity:Recognizes human TSG6. Species Crossreactivity: rat
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu Rt
Immunogen:Synthetic peptide corresponding to aa46-91, KYKLTYAEAKAVCEFEGGHLATYKQLEAARKIGFHVCAAGWMAKGR from human TSG6, different from the related mouse sequence by 2aa.