Tissue factor pathway inhibitor 2, also known as TFPI2, is a human gene which is located at 7q22.
It is an important regulator of the extrinsic pathway of blood coagulation through its ability to inhibit factor Xa and factor VIIa-tissue factor activity.
After a 22-residue signal peptide, the mature TFPI2 protein contains 213aa with 18 cysteines and 2 canonical N-linked glycosylation sites.
The purified recombinant TFPI2 strongly inhibited the amidolytic activities of trypsin and the factor VIIa-tissue factor complex.
The latter inhibition was markedly enhanced in the presence of heparin.
Mouse TFPI2 mRNA is highly expressed in developing mouse placenta, as in human.
And there are also high transcript levels in adult mouse liver and kidney.
Applications:Suitable for use in Western Blot, Immunohistohemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlImmunohistochemistry (paraffin): 0.5-1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder in 5mg/ml BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O to ~0.5mg/ml.
Specificity：Recognizes human TFPI2. Species Crossreactivity: mouse
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu Mo
Immunogen：Synthetic peptide corresponding to aa70-105, EGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQ from human TFPI2 at N-terminal.
