ATP-binding cassette transporter sub-family C member 8 is a protein that in humans is encoded by the ABCC8 gene.
The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters.
ABC proteins transport various molecules across extra- and intra-cellular membranes.
ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White).
This protein is a member of the MRP subfamily which is involved in multi-drug resistance.
This protein functions as a modulator of ATP-sensitive potassium channels and insulin release.
Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion.
Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion.
Alternatively spliced transcript variants have been found for this gene.
Applications:Suitable for use in Western Blot, Immunohistochemistry Immunocytochemistry, Flow Cytometry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlImmunohistochemistry (frozen): 0.5-1ug/mlImmunocytochemistry: 0.5-1ug/mlFlow Cytometry: 1-3ug/1x10e6 cellsOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size:100ug
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by immunoaffinity chromatography.
Form:Supplied as a lyophilized powder in 5mg/ml BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O to ~0.5mg/ml.
Specificity:Recognizes human SUR1. Species Crossreactivity: mouse and rat
Isotype:IgG
Calc Applications Abbrev:FC IC IHC WB
Calc Crossreactivity:Hu Mo Rt
Immunogen:Synthetic peptide corresponding to TIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVTERKA from human SUR1.