Cationic amino acid transporter 3 is a protein that in humans is encoded by the SLC7A3 gene.
This gene encodes a member of the solute carrier family 7.
The encoded protein is a sodium-independent cationic amino acid transporter.
Alternate splicing results in multiple transcripts that encoded the same protein.
The International Radiation Hybrid Mapping Consortium mapped the SLC7A3 gene to the X chromosome.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder in 5mg/ml BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O to ~0.5mg/ml.
Specificity：Recognizes human SLC7A3.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide corresponding to aa1-30, MPWQAFRRFGQKLVRRRTLESGMAETRLAR from human SLC7A3 at N-terminal, different from the related mouse and rat sequences by 4aa.
