GABA transporter 1 (GAT1), also known as sodium- and chloride-dependent GABA transporter 1, is a protein that in humans is encoded by the SLC6A1 gene.
GABA Transporter 1 uses Na+ and Cl- to create a gradient, which removes or adds GABA to extracellular spaces in the cerebrum and cerebellum.
The stoichiometry for GABA Transporter 1 is 2 Na+: 1 Cl-: 1 GABA.
The activity of GAT1 is largely dependent on the presence of Na+, while Cl- assists by increasing the ability for GAT-1 to uptake GABA.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder in 5mg/ml BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O to ~0.5mg/ml.
Specificity：Recognizes human SLC6A1. Species Crossreactivity: mouse and rat
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu Mo Rt
Immunogen：Synthetic peptide corresponding to aa23-54, ANDKPKTLVVKVQKKAADLPDRDTWKGRFDFL from human SLC6A1 at N-terminal, different from the related mouse and rat sequences by 2aa.
