Relaxin 1 is a member of relaxin-like peptide family.
Relaxin gene maps to human chromosome 19 near D19Mit23.
Relaxin is a peptide hormone produced by the corpora lutea of ovaries during pregnancy in many mammalian species, including man.
Relaxin widens the pubic bone and facilitates labor, it also softens the cervix (cervical ripening), and relaxes the uterine musculature.
However, its significance may reach much further.
Relaxin affects collagen metabolism, inhibiting collagen synthesis and enhancing its breakdown by increasing matrix metalloproteinases.
It also enhances angiogenesis and is a potent renal vasodilator.
Applications:Suitable for use in Western Blot, Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlImmunohistochemistry (paraffin): 0.5-1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder in 5mg/ml BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O to ~0.5mg/ml.
Specificity：Recognizes human Relaxin 1. Species Crossreactivity: rat
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu Rt
Immunogen：Synthetic peptide corresponding to VAAKWKDDVIKLCGRELVRAQIAICGMSTW from human Relaxin 1.
