cGMP-specific phosphodiesterase type 5 is an enzyme from the phosphodiesterase class.
It is found in various tissues, most prominently the corpus cavernosum and the retina.
It has also been recently discovered to play a vital role in the cardiovascular system.
Furthermore, PDE5A also plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides.
This PDE5A gene is mapped to 4q26.
Applications:Suitable for use in Western Blot, Immunohistohemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlImmunohistochemistry (paraffin): 0.5-1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder in 5mg/ml BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O to ~0.5mg/ml.
Specificity：Recognizes human PDE5A. Species Crossreactivity: rat
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu Rt
Immunogen：Synthetic peptide corresponding to aa20-63, QKQQQRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVH from human PDE5A at N-terminal, different from the related mouse sequence by 8aa.
