RNA-binding protein Musashi homolog 1 is a protein that in humans is encoded by the MSI1 gene.
This gene encodes a protein containing two conserved tandem RNA recognition motifs.
Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation.
Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas.
A pseudogene for this gene is located on chromosome 11q13.
Applications:Suitable for use in Western Blot, Immunohistohemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlImmunohistochemistry (paraffin): 0.5-1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size:100ug
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by immunoaffinity chromatography.
Form:Supplied as a lyophilized powder in 5mg/ml BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O to ~0.5mg/ml.
Specificity:Recognizes human Musashi 1/Msi1. Species Crossreactivity: mouse and rat
Isotype:IgG
Calc Applications Abbrev:IHC WB
Calc Crossreactivity:Hu Mo Rt
Immunogen:Synthetic peptide corresponding to aa21-54, KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD from human Musashi 1/Msi1 at N-terminal. Species sequence homology: mouse and rat