Leptin receptor, also known as LEPR or OB-R is a protein that in humans is encoded by the LEPR gene.
The protein encoded by this gene belongs to the gp130 family of cytokine receptors that are known to stimulate gene transcription via activation of cytosolic STAT proteins.
This protein is a receptor for leptin (an adipocyte-specific hormone that regulates body weight), and is involved in the regulation of fat metabolism, as well as in a novel hematopoietic pathway that is required for normal lymphopoiesis.
Mutations in this gene have been associated with obesity and pituitary dysfunction.
Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Applications:Suitable for use in ELISA, Immunohistohemistry.
Other applications not tested.
Recommended Dilution:ELISA: 0.1-0.5ug/mlImmunohistochemistry (paraffin): 0.5-1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder in 5mg/ml BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O to ~0.5mg/ml.
Specificity：Recognizes human LEPR. Species Crossreactivity: mouse and rat
Isotype：IgG
Calc Applications Abbrev：E IHC
Calc Crossreactivity：Hu Mo Rt
Immunogen：Synthetic peptide corresponding to aa793-839, KKYYIHDHFIPIEKYQFSLYPIFMEGVGKPKIINSFTQDDIEKHQSD from human LEPR at C-terminal, different from the related mouse sequence by 9aa and from the related rat sequence by 8aa.
