FDC-SP or follicular dendritic cell-secreted protein, is a small, secreted protein, located on chromosome 4 in humans.
FDC-SP is a 68aa protein containing a signal peptide at its N-terminal, which is used for directing the transport of the protein.
This protein specifically binds to activated B cells, and functions as a regulator of antibody responses.
It is also thought to contribute to tumor metastases by promoting cancer cell migration and invasion.
Applications:Suitable for use in Immunohistohemistry.
Other applications not tested.
Recommended Dilution:Immunohistochemistry (paraffin): 0.5-1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder in 5mg/ml BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O to ~0.5mg/ml.
Specificity：Recognizes human FDCSP.
Isotype：IgG
Calc Applications Abbrev：IHC
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide corresponding to aa18-51, FPVSQDQEREKRSISDSDELASGFFVFPYPYPFR from human FDCSP.
