This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins.
The encoded protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex.
Overexpression of this gene has been associated with acute myelocytic leukemia.
A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder in 5mg/ml BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O to ~0.5mg/ml.
Specificity：Recognizes human ANXA8.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide corresponding to aa20-61, HFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAK from human ANXA8 at N-terminal, different from the related mouse and rat sequences by 1aa.
