Amylase is an enzyme that catalyses the breakdown of starch into sugars.
Amylase is present in human saliva, where it begins the chemical process of digestion.
By in situ hybridization combined with high resolution cytogenetics, the amylase gene is mapped to 1p21.
Amylase enzymes find use in bread making and to break down complex sugars such as starch (found in flour) into simple sugars.
Yeast then feeds on these simple sugars and converts it into the waste products of alcohol and CO2.
Applications:Suitable for use in Western Blot, Immunohistohemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlImmunohistochemistry (paraffin): 0.5-1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder in 5mg/ml BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O to ~0.5mg/ml.
Specificity：Recognizes human Alpha Amylase 1. Species Crossreactivity: mouse and rat
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu Mo Rt
Immunogen：Synthetic peptide corresponding to aa20-50, NTQQGRTSIVHLFEWRWVDIALECERYLAPK from human Alpha Amylase 1 at N-terminal, different from the related mouse sequence by 5aa, and from the related rat sequence by 6aa.
