Aldo-keto reductase family 1 member B10 is an enzyme that in humans is encoded by the AKR1B10 gene.
This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins.
This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses.
It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.
Applications:Suitable for use in Western Blot, Immunohistohemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlImmunohistochemistry (paraffin): 0.5-1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder in 5mg/ml BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O to ~0.5mg/ml.
Specificity：Recognizes human AKR1B10.
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide corresponding to aa285-316, EMATILSFNRNWRACNVLQSSHLEDYPFNAEY from human AKR1B10 at C-terminal.
