Allograft inflammatory factor 1 (AIF-1), also known as ionized calcium-binding adapter molecule 1(IBA1), is a protein that in humans is encoded by the AIF1 gene.
This gene encodes a protein that binds actin and calcium.
And this gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes.
Polymorphisms in this gene may be associated with systemic sclerosis.
Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain.
Applications:Suitable for use in Western Blot, Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlImmunohistochemistry (paraffn): 0.5-1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder in 5mg/ml BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O to ~0.5mg/ml.
Specificity：Recognizes human AIF1.
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide corresponding to aa99-133, ETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEK from human AIF1 at C-terminal, different from the related mouse sequence 7aa and from the related rat sequence by 6aa.
