Vasodilator-stimulated phosphoprotein (VASP) is a member of the Ena-VASP protein family.
Ena-VASP family members contain an EHV1 N-terminal domain that binds proteins containing E/DFPPPPXD/E motifs and targets Ena-VASP proteins to focal adhesions.
In the mid-region of the protein, family members have a proline-rich domain that binds SH3 and WW domain-containing proteins.
Their C-terminal EVH2 domain mediates tetramerization and binds both G and F actin.
VASP is associated with filamentous actin formation and likely plays a widespread role in cell adhesion and motility.
VASP may also be involved in the intracellular signaling pathways that regulate integrin-extracellular matrix interactions.
VASP is regulated by the cyclic nucleotide-dependent kinases PKA and PKG.
Applications: Suitable for use in Western Blot, Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlImmunohistochemistry (paraffin): 0.5-1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes human VASP. Species Crossreactivity: mouse, rat
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu Mo Rt
Immunogen：Synthetic peptide corresponding to a sequence at the N-terminal of human VASP (aa78-114, NFHQWRDARQVWGLNFGSKEDAAQFAAGMASALEALE), different from the related mouse sequence by 4aa.
