Tubulin beta-3 chain is a protein that in humans is encoded by the TUBB3 gene.
This gene encodes a class III member of the beta tubulin protein family.
Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules.
This protein is primarily expressed in neurons and may be involved in neurogenesis and axon guidance and maintenance.
Mutations in this gene are the cause of congenital fibrosis of the extraocular muscles type 3.
Alternate splicing results in multiple transcript variants.
A pseudogene of this gene is found on chromosome 6.
Applications: Suitable for use in Western Blot, Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlImmunohistochemistry (paraffin): 0.5-1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes human TUBB3. Species Crossreactivity: mouse, rat.
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu Mo Rt
Immunogen：Synthetic peptide corresponding to a sequence at the C-terminal of human Beta III Tubulin (aa383-412, EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE), identical to the related mouse and rat sequences.
