Nuclear factor 1 A-type is a protein that in humans is encoded by the NFIA gene.
Nuclear factor I (NFI) proteins constitute a family of dimeric DNA-binding proteins with similar, and possibly identical, DNA-binding specificity.
They function as cellular transcription factors and as replication factors for adenovirus DNA replication.
Diversity in this protein family is generated by multiple genes, differential splicing, and heterodimerization.
Applications: Suitable for use in Western Blot, Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlImmunohistochemistry (paraffin): 0.5-1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes human NFIA. Species Crossreactivity: mouse, rat
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu Mo Rt
Immunogen：Synthetic peptide corresponding to a sequence in the middle region of human NFIA (aa180-224, AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSG VFS), different from the related mouse sequence by 1aa, and identical to the related rat sequence. Species Sequence Homology: bovine, chicken, canine, hamster, equine, monkey, rabbit.
