Collagenase 3 is an enzyme that in humans is encoded by the MMP13 gene.
This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs).
Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis.
The encoded preproprotein is proteolytically processed to generate the mature protease.
This protease cleaves type II collagen more efficiently than types I and III.
It may be involved in articular cartilage turnover and cartilage pathophysiology associated with osteoarthritis.
Mutations in this gene are associated with metaphyseal anadysplasia.
This gene is part of a cluster of MMP genes on chromosome 11.
Applications: Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes human MMP13.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide corresponding to a sequence at the N-terminal of human MMP13 (aa109-154, RTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFT), different from the related mouse sequence by 4aa, and from the related rat sequence by 5aa.
