LRIG3 (leucine-rich repeats and Ig-like domains-3) is a 140kD type I transmembrane glycoprotein member of the mammalian LRIG glycoprotein family.
It shares 46.8% and 54.0% amino acid identity with LRIG1 and LRIG2, respectively, with highest conservation in the extracellular, transmembrane, and membrane-proximal sequences.
This gene is mapped to chromosome 12q13.2.
LRIG3 may play a role in craniofacial and inner ear morphogenesis during embryonic development.
It also may act within the otic vesicle epithelium to control formation of the lateral semicircular canal in the inner ear, possibly by restricting the expression of NTN1.
Applications: Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilutions:Western Blot: 0.1-0.5ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 0.05% sodium azide, 4% trehalose. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes human LRIG3. Species Crossreactivity: rat
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu Rt
Immunogen：Synthetic peptide corresponding to a sequence in the middle region of human LRIG3 (aa428-465, NAFSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAENNFQ), different from the related mouse sequence by 1aa.
