High-mobility group protein B2, also known as high-mobility group protein 2 (HMG-2), is a protein that in humans is encoded by the HMGB2 gene.
This gene encodes a member of the non-histone chromosomal high mobility group protein family.
The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells.
In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles.
These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility.
This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination.
Applications: Suitable for use in Western Blot, Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlImmunohistochemistry (paraffin): 0.5-1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes human HMGB2. Species Crossreactivity: mouse, rat
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu Mo Rt
Immunogen：Synthetic peptide corresponding to a sequence at the N-terminal of human HMGB2 (aa65-97, KSDKARYDREMKNYVPPKGDKKGKKKDPNAPKR), identical to the related mouse and rat sequences. Species Sequence Homology: hamster.
