GRB2-associated-binding protein 1 is a protein that in humans is encoded by the GAB1 gene.
It is mapped to 4q31.21.
The protein encoded by this gene is a member of the IRS1-like multisubstrate docking protein family.
It is an important mediator of branching tubulogenesis and plays a central role in cellular growth response, transformation and apoptosis.
Two transcript variants encoding different isoforms have been found for this gene.
Applications: Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes human GAB1. Species Crossreactivity: rat
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu Rt
Immunogen：Synthetic peptide corresponding to a sequence at the N-terminal of human GAB1 (aa72-109, LTFNKKEFENSYIFDINTIDRIFYLVADSEEEMNKWVR), different from the related mouse sequence by 1aa.
