Epithelial cell adhesion molecule (EpCAM) is a transmembrane glycoprotein mediating Ca2+-independent homotypic cell–cell adhesion in epithelia.
This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins.
This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule.
The antigen is being used as a target for immunotherapy treatment of human carcinomas.
Mutations in this gene result in congenital tufting enteropathy.
Applications: Suitable for use in Western Blot, Immunohistochemistry, ELISA.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlImmunohistochemistry (paraffin): 0.5-1ug/mlELISA: 0.1-0.5ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes human EPCAM.
Isotype：IgG
Calc Applications Abbrev：E IHC WB
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide corresponding to a sequence in the middle region of human EPCAM (aa147-189, ELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENN), different from the related mouse sequence by15aa, and from the related rat sequence by 16aa.
