CPM, mapped to 12q15, is known as Carboxypeptidase M.
The protein encoded by this gene is a membrane-bound arginine/lysine carboxypeptidase.
Its expression is associated with monocyte to macrophage differentiation.
This encoded protein contains hydrophobic regions at the amino and carboxy termini and has 6 potential asparagine-linked glycosylation sites.
The active site residues of carboxypeptidases A and B are conserved in this protein.
Three alternatively spliced transcript variants encoding the same protein have been described for this gene.
Applications: Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes human CPM.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide corresponding to a sequence at the C-terminal of human CPM (aa286-316, KYPREEKLPSFWNNNKASLIEYIKQVHLGVK), different from the related mouse sequence by 2aa.
