Cell division protein kinase 6, also called Plstire, is an enzyme that in humans is encoded by the CDK6 gene.
The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family.
Radiation hybrid analysis and inclusion within a mapped clone place the CDK6 gene at 7q21.
Serine/threonine-protein kinase involved in the control of the cell cycle and differentiation and promotes G1/S transition.
This gene also involved in initiation and maintenance of cell cycle exit during cell differentiation.
It prevents cell proliferation and regulates negatively cell differentiation, but is required for the proliferation of specific cell types.
In addition, CDK6 plays a role in promoting the proliferation of beta-cells in pancreatic islets of Langerhans.
Applications: Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes human CDK6. Species Crossreactivity: rat
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu Rt
Immunogen：A synthetic peptide corresponding to a sequence at the N-terminal of human Cdk6 (aa119-150, TETIKDMMFQLLRGLDFLHSHRVVHRDLKPQN), identical to the related mouse sequence. Species sequence homology: bovine
