C-C chemokine receptor type 1 is a protein that in humans is encoded by the CCR1 gene.
This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors.
The ligands of this receptor include macrophage inflammatory protein 1 alpha (MIP-1 alpha), regulated on activation normal T expressed and secreted protein (RANTES), monocyte chemoattractant protein 3 (MCP-3), and myeloid progenitor inhibitory factor-1 (MPIF-1).
Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation.
Knockout studies of the mouse homolog suggested the roles of this gene in host protection from inflammatory response, and susceptibility to virus and parasite.
Applications: Suitable for use in Western Blot, Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlImmunohistochemistry (paraffin): 0.5-1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size:100ug
Host:rabbit
Source Antibody:mouse
Grade:Affinity Purified
Purity:Purified by immunoaffinity chromatography.
Form:Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity:Recognizes mouse CCR1. Species Crossreactivity: human, rat
Isotype:IgG
Calc Applications Abbrev:IHC WB
Calc Crossreactivity:Hu Mo Rt
Immunogen:Synthetic peptide corresponding to a sequence at the C-terminal of mouse CCR1 (aa260-290, FVSAFQDVLFTNQCEQSKQLDLAMQVTEVIA), different from the related human sequence by 9aa. Species Sequence Homology: hamster.