APC2, which is also called APCL, is a deduced 2303aa protein that contains an N-terminal coiled-coil domain, followed by an armadillo domain and five 20aa repeats.
The human APC2 gene is mapped to chromosome 19p13.3.
It is found that the 20aa repeat domain of APCL could bind beta-catenin (CTNNB1) and deplete the intracellular beta-catenin pool.
A reporter gene assay revealed that APCL could regulate interaction of beta-catenin with T cell-specific transcription factors (TCF7), although less efficiently than APC.
Applications: Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes human APC2.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide corresponding to a sequence at the N-terminal of human APC2 (aa51-90, KHLQGKLEQEARVLVSSGQTEVLEQLKALQMDITSLYNLK), different from the related mouse sequence by 2aa. Species Sequence Homology: bovine, monkey.
