Aldehyde dehydrogenase X, mitochondrial is an enzyme that in humans is encoded by the ALDH1B1 gene.
This protein belongs to the aldehyde dehydrogenases family of proteins.
Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism.
This gene does not contain introns in the coding sequence.
The variation of this locus may affect the development of alcohol-related problems.
Applications: Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size:100ug
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by immunoaffinity chromatography.
Form:Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity:Recognizes human ALDH1B1. Species Crossreactivity: mouse, rat
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu Mo Rt
Immunogen:Synthetic peptide corresponding to a sequence at the N-terminal of human ALDH1B1 (aa116-156, RVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADK W), different from the related mouse sequence by 1aa, and from the related rat sequence by 2aa. Species Sequence Homology: hamster.