GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1).
GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system.
Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion.
When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection.
GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake.
GLP-2 and related analogs may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy.
Applications:Suitable for use in ELISA, Western Blot, Immunohistochemistry and Immunocytochemistry.
Other applications not tested.
Recommended Dilutions:Western Blot: 0.5-2ug/mlImmunohistochemistry: 5-20ug/mlImmunocytochemistry: 5-20ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：200ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A and peptide affinity chromatography
Form：Supplied as a liquid in PBS, pH 7.4, 0.05% Proclin-300, 50% glycerol
Specificity：Recognizes human GLP2
Isotype：IgG
Calc Applications Abbrev：E IC IHC WB
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide corresponding to His146-Arg179, HADGSFSDEMNTILDNLAARDFINWLIQTKITDR of human GLP2, conjugated to OVA.
