Regulator of nonsense transcripts 3B is a protein that in humans is encoded by the UPF3B gene.
This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance.
The encoded protein is one of two functional homologs to yeast Upf3p.
mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD).
When translation ends upstream from the last exon- exon junction, this triggers NMD to degrade mRNAs containing premature stop codons.
This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein.
It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions.
This gene is located on the long arm of chromosome X.
Two splice variants encoding different isoforms have been found for this gene.
Applications:Suitable for use in Western Blot, Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlImmunohistochemistry (paraffin): 0.5-1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder in 5mg BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05mg sodium azide. Reconstitute with 200ul sterile dH2O to ~0.5mg/ml.
Specificity：Recognizes human UPF3B/RENT3B. Species Crossreactivity: mouse and rat
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu Mo Rt
Immunogen：Synthetic peptide corresponding to aa416-452, SEKTEKKEEVVKRDRIRNKDRPAMQLYQPGARSRNRL, of human UPF3B/RENT3B at C-terminal.
